dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|91776969|ref|YP_546725.1| (Methylobacillus flagellatus KT)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (2Fe-2S)-binding [Methylobacillus flagellatus KT]
Sequence length 153
Sequence
MVTLDINGESRQLDVPNEMPLLWAIRDVAQLTGTKFGCGMALCGACTIHLDSEPVRACVT
PVSAAVGKKITTVEAVGEDKVGKAVQAAWLELGVAQCGYCQAGQIMSATALLRSTLHPTD
EDIDEAMSGNICRCGTYPRIRAAIKLAAKEGAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]