dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|50364881|ref|YP_053306.1| (Mesoplasma florum L1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Mfl066 [Mesoplasma florum L1]
Sequence length 317
Sequence
MSFALTVKEEVISHTFDDNLGQAFLAGFIKYNGDFIWGSGTEKLKLTSISNKIARSIFGL
CKKMFDGHIEISVSQTQTLKQNKTYQITLIGKISEFLRELNIWNENNTKIVEFKPLKQEK
NKDELIKLKRAYMAGVFVSVGSVNSPETTNYHLELQFKDEESALYIIKLMNKYGFDFKIL
KRNDKLFICYIKKAIMVSDFLKFIDAYQAVMNFENERIMRDVSNNVNRVNNIDISNEKKT
LSAGLKQIDQISKIQANLATKRLSEKAAYLCDLRIQNPNASYADLTELMNEFGYEITKSG
VSNLFKIIEKLSLEFNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]