dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr1g035650.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | hypothetical protein | LC | chr1:13003263-13002380 | 20130731
Sequence length 206
Sequence
MSFYHPKKFFKIMRNQELQNGELRVPKYFVKLHWKNVSNPVAFTLPNGSKQDVFWVEHNG
DIWFQKNWETIAKSLIRGHVLVFKYKGGSCFKVEIFGCNTLELDYSNIKVEAEEVVVVSN
DNVTNTNGAGTSQRRKGGKRKMNMDLDANQKKIKGSNRGGMIKKAKKCLRTEAVKERVRN
YHPLENPSFEVEMSQSYAKGCYLEYY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]