dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr1g102710.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | Serine/Threonine kinase | HC | chr1:46423862-46415204 | 20130731
Sequence length 1637
Sequence
MKEKSECFECLQLRINSDFSDQLVFNYAISNSPFPFGSSAILHITSSEDGEAPSGQFILQ
YMSSHHNNCFTNYVNQYILDSNENTKSDDLDVSHGGNGFTTCNHSGRFSCSRTISGIAPI
ACVGKSSYSILQQVANDFLSGLTEDHVLKSLDLFVEGKASGRDSTNFLSLIGFPSFEENN
FPGSLRHPNIAPVLAILKTSGYTNMVLPKTQYNLESILHFNPNALKSDWHRRFLIYQLLS
ALLYLHGLGVSHGNICPSNIMLTDSLWSWLRLWNEPVLESKLTLQESESVKSKPAKIGCC
NDGCHSNDLYADLKLSPLIDWHSSFHQWWKGELSNFEYLLILNRLAGRRWGDHTFHPVMP
WVVDFSSKPDDNCDVGWRDLSKSKWRLAKGDEQLDFTYSTSEIPHHVSDECLSELAVCSY
KARRLPLSVLRMAVRSVYEPNEYPSSMQRLYQWTPDECIPEFYCDPQIFSSVHDGMADLA
TPSWAESPEDFIKLHRDALESNRVSFQLHHWIDIIFGYKMSGEAAIVAKNVMLTQSESTM
PRSTGRRQLFMRPHPIRHATAKITRNGSNKYAKVLTQTNEMQRETSLLSETAYLQELEQA
SAFSEHARHLNACYRYPLNQMKRKNISSLGDPTTGTFTKNISDVSFIDKNYRLPNKMNHI
SFLQHMKEEDEGFSGYPDLLLWRQKLSSSRLASEDIARDIFSVGCLLAELHLCRPLFDSI
SLEIYLEDGTLPGFLQELPPHVRILVEACIQKDWMRRPSAKILLDSPYFPKTIKSSYLFL
APLQLVAKDESRLHFAANLAKQGALRQMGTFATEMCATYCLPLIVNVASDTEAEWAYILL
KELMKCLTAQTVKILILPTIQKILQNTGYLHLKVSLLQDSFVREIWNRVGKQAYLETIHP
LVLSNLYISPDKNSAASASVLLIGSSEEIGVPITINQTILPLVHCFGKGLCVDGIDVLVR
IGGIFGESFIVKQMLPLLKNVVRSFIDVSFVNKPDPVQSWSSLALIDCMMTLDGLVAFLT
EEVIVKELLEDISCIHVGVLMQKHMEITVLQVAANTLFGICQRIGADLTALHILPKLKEL
FDELAFSQEISKGSTAVSRNSKVTKLKIGGDFQIESRMDLVLLLYTLFASLLGIEKLRQC
CATWLLLEQLLLRRHNWKWEYAGESSRNSSESNIAKRPAIAQGFTSEYNPAKLLLNGVGW
SIPQSQGSRGAKNLIQRRPFKVHQSLVVMQEGMSNQVNHEPWFWFPSPATNWDGPAFLGR
VGIQKDDLPWKIRASVSYSIRAHHGAVRSLAVHQDESTVYTAGIGQGYKGTVMKWELSRT
NCLSGYYGHEEVVNDICILSSSGRVASCDGTIHIWDSQTGKQISVFAESETESGHPTNHS
ASVPKITSDQANVLNLNTLSNGMLSSAFDSSLYTCMHLLDSAETLVVGTGNGSLRFIDVA
RGQKLHIWRGESNESSFHSLISAVCSSGSSKAQAGGISTSPSLIATGQSSGHCKLFDAKS
GNVVASWRAHDGYVTKLASPEEHLLISSSLDRTLRVWDLRMNLPSQPIIFRGHSDGISSF
SIWGQDVISISRNRIGLLSLSKSAIETDGQHQIIPQKLYVSSDNGMRSLSALSSISILPF
SRLFLIGTEDGYLRICC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]