dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr3g061300.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | B3 DNA-binding domain protein | LC | chr3:24346545-24347031 | 20130731
Sequence length 127
Sequence
mktserttswnwpkgaraqevalkfistnpfftilinpthlaenrvcvptlngvienkek
yvmlqigkrswnlkllpycearnvrrlsagwslfaresglqagdvcvfelinkkdlvfni
hitksds

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]