dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr3g075140.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | B3 DNA-binding domain protein | HC | chr3:34145228-34144189 | 20130731
Sequence length 251
Sequence
MYDISTFLYSTCEAILNILCPKIRKGYIQHFLHPRVFLFILLPFRAPRENKNSAMVRNQQ
DLPSKLNPTMSLLVDQKINLEDSTGKRWAITVSEVDGSFAFKKGWDDFSSAHKLEIGDLL
VFNCINKYNFDVKIYDQSMCERIDFSDKRKRKKRSRCSSGSLDAGGTPNSVEVVSENVNV
DRSVKCPRTSEDTSYIRNHVYLNDAAIFNNDPMFEEVLGSGDTSYASKFGLLDRKDFFWS
QVQDSQVTESL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]