dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr3g100060.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | BEACH domain LvsC-like protein, putative | HC | chr3:45964613-45936555 | 20130731
Sequence length 3254
Sequence
MNIVKGVADLIRRTSSGHSGESSSFHAQKFSPPGPKIRFSDAGDEAIVNTLWERYQKNDD
KVEKKRLLHVFIKQFVVVYKDWEPINSGILLESASVEKFSSADDVVVGCSAGHPVEVIRV
LVDEVTQLSSLVTELSTSILQSTELSGAATKSYITSEGFLILDALKIIARSLYNCRVFGY
YGGIQKLTALMKGAVVQLKTISGALSADESLSDFVLEKIKLLQQILIYVVSIFYVFIDLG
SNIDKKDELFCSLVGFISRVDAAISSSNSSKVLSTEARLHWRQKAIVSVMEAGGLNWLVE
LLRLCRRFSLKELLMDDSLQYLSLKILSLALSANPRGQNHFKSIGGLEVLLDSLGFPSNY
ATTYRKFVLTNGFRDDQPLQKIFQLHILALEVLREAVFGNMNNLQFLCENGRIHKFANSF
CSPAFVLQDLRQGEDFAGQQAVSVPGLDIHENKNNMKFDPAMASAGLTPDASFSHFWNDY
VLMLSRSLCSFLIVPGASKSLNIQLSSGRLALPVSSSYCELSIKWVIRVLFTLFPCIKAC
SNQNDLPSYLRVFVTILQNTVLNAFKNLLSTSPMSLENFREEGIWDLIFSENFFYFESGL
EEIGRQVFAYNEKSELLSASSSTVDKPEVNGVRSLQMEIMSFVEFAATSNGNTHNMTELS
ALLDALEHSACNPEIAGLLVRSLVRILQLSPEKTITSCKTLNAVSRVLQVACVQAQECKR
SGSMDPSSVNSGLEVLESVPDQPNCNSPETVQNWFGCMKMCMEFFTKFFASAEDTKSFIL
HSFASIDCLFDLFWIEGLRDDVLRHILDLMKIIPISEEDKKAKLQLCSKYLEMFTQIKER
EKFFVDLSVDMLAGMREMLLANQAYYQALFRDGECFLHVVSLLNSDLDEGKGERLVLNVL
QTLTHLLANNDTSKAAFRALAGKGYQTLQSLLLDFCQWHSSESLLDALLDMLVDGKFDIK
ISPIIKNEDVIILYLIVLQKSSESLKHNGLEVFQQLLRDSISNRASCVRAGMLDFLLNWF
CQEDNDSVIFQIAQLIQAIGGHSISGKDIRKIFALLRSEKVGMRRHYGSVLLTSLLSMLH
EKGPTAFFDLNGIDSGIILKTPLQWPLNKGFSFSCWLRIENFPRNGTMGLFGFLTENGRG
SLAVISKEKLTYESINLKRQRSDLHVNLVRRRWHFLCITHSIGRAFSGGSLLRCYLDGGL
VSSERCRYAKISEPLTSCMVGAKLKMPNYEDSTLTFESIRDSCPFFGQIGPVYLFNDAIS
SEQVQSIYSLGPSYMYSFLDNETLPVSGDKMPSGILDAKDGLASRIIFGLNAQASVGRML
FNVSPIMSHAVDKNSFEATVIGGTQLCSRRMLQQIMYCVGGVSVLFPLITQWCNFENEVG
ESEKTPLMQSTRECMMGEVIELIASLLDENVANQQQMHIVSGFSVLGFLLQSVPPQQLNL
ETLSALKHLFNVVSNSGLAELLVEEAISSIFLNPLIWVCTVYKVQRELYMFLIQQFDNDP
RLLKSLCRLPRVLDIIHQFYCDNVKSRLYIGNNLLQHPVSKKVIGERPSKEEMHKIRLLL
LSLGEMSLRQNIAAGDMKALIAFFETSQDMTCIEDVLHMIIRAVSQKSLLASFLEQVNII
NGSQVFVNLLQREYESIRLLSLQFLGRLLVGLPSEKKGSRFFNLPMGRSKSISENYRKIR
MQPIFLAISDRLFSFPQTENLCATLFDVLLGGASPKQVLQRHSHLERVKSKGSSSHFLLP
QMLLLIFRYLSGCEDTDARIKIIRDILDLLDSNASNIEAFMEYGWNAWLTSSLKLGVLTD
KNVKLPNHGNSTMDELLVVRNLFSLVLCHYLHSVKGGWQQLEETVNFLVMHSEEGGNSYR
FFLRDIYEDVIQNLVDLSASDNIFISQPCRDNTLYLLKLIDEMLISEIDKELPLLGSESD
FHLDLEMECHKEYSSALKDVLIGEVDEQTSRKSQNLKQPVPCDDTIEEKWWNLYDNLWVV
ISKMNGKGPSSVLPKSSSFAGPSLGQRARGLVESLNIPAAEVAAVVVSGGMIGNALTPKP
NKNVDKAMVLRGERCPRIIYHLVILYLCKSSLEKSSRCVQQFTSLLPCLLTADDEQSKIR
LQLIIWVLLFVRSQYGMLDDGARFHLLSHLIRETVNIGKSMLATSLVSRDDTLDPNYNLK
DAGSIQNLIQKDRVLAAISDEANYTQISKIDRAQQVQELHIRIDENTLAESSSKQALEDE
IQNSLNSILSSDDSRRAEFQLTYEEEQQNVAEKWIHMFRSLIDERGPWSTKPFPNCIVTH
WKLDKTEDTWRRRPKLRQNYHFDENLCNPPSATASGIASPVNESNPGFVGNIPEQMKQLL
LKGIRKITDEGTFDSNETNTEISGPNTSIPPDHSDSHSSDLLKDNSDRKDVVHERRDTPS
SPETEASKVLVSIPCVLVTPKRKLAGHLAVMKNVLHFFAQFLVEGTGGSSVFRNFDALNN
SDLTKSVQKQRSMKWPASDMDLQKGITVGNVEVINGNGPVKLMRCVKRHRRWSLAKIKAV
HWTRYLLRYTAIEIFFSDSISPVFLNFASQKDAKDIGNLIVATRNEYLFPKGSGRDKNGP
INFVDRRVAQEMAETARESWRRRDITNFEYLMILNTLAGRSFNDLTQYPVFPWVLADYTS
EVLDYNRSSTFRDLSKPVGALDTKRFEVFEDRYRNFCDPDIPSFYYGSHYSSMGIVLYYL
LRLEPFTSLHRNLQGGKFDHADRLFQSIEGTFKNCLTNTSDVKELIPEFFYMPEFLLNSN
SYHLGVRQDGEPIGDVFLPPWSKGSPEEFIRRNREALESEYVSSNLHHWIDLVFGYKQRG
KPAVEAANIFYYLTYEGAVDLETTEDDLQRAAIEDQIANFGQTPIQMFRKKHPRRGPPIP
IARPLYFAPDSISLTSIVSNTSQSSSAILYVGLMDSNVILVNEGLNLSVKTWVSTQLQSG
GNFTFSGSQDYFFGVGSEMLSPRKIGIPVPEHVELGEQCFATMQAPSENFLISCGNWENS
FQVISLSDGRMVQSIRQHKDVVSCIAVTSDGSILATGSYDTTVMVWEVFRGKTEKRIRNS
QSELPRKNYVIIETPCHILCGHDDIITCLHVSHELDIIISGSKDGTCVFHTLREGRYVRS
IRHPSGSPISKLVVSQHGQIVIYADDDLSLHLYSINGKHLATSESNGRLNTIQLSRCGEF
LVGAGDQGQIVVRSINTLEVVKKYQGVGKVLTSLTVTPEECFLAGTKDGSLLVYSIENPQ
LRKTSHSKSTKSKT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]