dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr4g083390.6 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | B3 DNA-binding domain protein | HC | chr4:32459292-32456722 | 20130731
Sequence length 133
Sequence
mqtggiepltgepyfhvvlskthlstrygmgpsssiceelpskevptilkyrgkswgmty
ngqnktkqfdsvswekfaednylklgdacvfelmknseeeivfkvqilrgeeepillsef
pgtgerdapfvid

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]