dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr4g119990.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | B3 DNA-binding domain protein | LC | chr4:49742159-49745391 | 20130731
Sequence length 377
Sequence
MSSTELDHRSNGVHFFKIILQRNLNEGKLKVPVSFVRRHWLGITNPVTLRLPNMTENKVF
WEKTSDYNVWFCNGWKEFAKYLSLGDSQLTLFQYQENSVFNVIVCGKCGLEIKYPLKETN
KEHEEVEESDTSLQIIEDPSSSKGKRLKSSPPYFKKMKINSKEQKEPKHEKRKVQEQGRF
LNFKDTDNGSSCDDLKERSKVLYDKVKNFFHADMDFFMCMIQKTYIKKDVLGIPIEFAKK
HLHRMEGRNITLFVDQDRPWNADLNLTLNNQYTLSGGWSKFRAHNNLKFGDICVFMLNKC
KGTVSFQVKIFSLEKDMSTPYFEVAWYLLGAEPTPASLGTSPGSAPTFFITSLGGWHRTT
LQRRKKIDWGGKCLGRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]