dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr7g018590.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | translation initiation factor eIF-2B delta subunit | HC | chr7:6058640-6065250 | 20130731
Sequence length 618
Sequence
MDARRPPRAVIDPKVRTVGFFTPPDPIQFDSNSLSPVMIPPPCHSSENLDLHSPPSVTPP
SGDESVSVTGSYNGSSSELFPAPMSPALSQKIVAGDGGVGGGIVASSFPRGGGVPVCKLT
TVSVVNTDSFAFDERDKPNKGGGSSMEVKDQAMNSKQKNEKSSKAERRALQEAQRAAKAA
AKAEGNKATGTVTSGNLKSAKATKPPQKVDNTSVAASEKKGVDRPSEKDRKKDVPHPRMQ
YDDKSRVEKAKRRAVVNHTESRNRVELFRHLPQYEHGSQLPDLEAKFFQLEPVHPSVYKV
GLQYLSGDISGGNARCIAMLQAFQDAIKDYTVPPEKTLVRDLTAKISSYVSFLIECRPLS
ISMGNAIRFLKSQIAKLPLTLSESESKTSLQSDIERFIYEKIILADKVIVEHAVTKIRDG
DVLLTYGSSSAVEMILLRAHELGKQFQVVVVDSRPSLKGKLLLRRLVEKGLTCTYTHINA
VSFIMHEVTRVFLGASSVLSNGTVYSGVGTASVAMVAHAFHVPVIVCCEAFKFHERVQLD
SICSNELGDPDVISKVSGRGDVNHLDAWANAENLQLLNLIYDATPSDYVSIIVTDYGMIP
PTSVPVVVREYSREQVWI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]