dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr7g025150.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | hypothetical protein | HC | chr7:8335904-8335048 | 20130731
Sequence length 223
Sequence
manfitmyhnppidhfravklsiqdrvevqpefvekykddlqdpwnimnmdggmhqikfk
msmynptlkdgwdplqqyhhfpdnvdiifgyygnnlfkvimfrevfcatkipsfhsrsmy
peeviifdihisdndfntpikmlpdhfgtflqndfrslltlccddgtiyfvdiihygdyv
ddpnsgiqwndfilsnyivagqklrfkfdltttymchvfpidv

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]