dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr7g075660.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | WD-40 repeat protein/beige protein | HC | chr7:28381508-28350580 | 20130731
Sequence length 2945
Sequence
MEEEDEPKEMKISGNELDSHGVVDSDLKRFVESPHEENVNGSSSFEVEHVDERVHLQDQD
VQCATTVMSEDQFEQVSLKDQDKNNESEYSNQSPGSDKIHRPYDGYAEDSRYSSGSCSIE
YDSSIVADLHLDNLSYSPGSEDKQFAPSFSFDSTGYSSVKSPPNPRQKHAKPNVSPELLH
LVDSAIMGKPEGIDKLKNIASGVEIFESGEEMDSVPFLIVDSLLATMGGVESFEEDEDNP
PSVMLNSRAAIVSGELIPWLPYIGDTDDVMSPRTRMVRGLLAIIRACTRNRAMCSSAGLL
GVLLRTAEKIFTVDVGLNGQMRWDGTPLCHCIQFLAGHSLSVSDLYRWFQVITKTLTTIW
APQLTLALEKAISGKESRGPASTFEFDGESSGLLGPGESRWPFVSGYAFATWIYIESFAD
TLNTATVAAAIAAAASARSGKSSAMSAAAAASALAGEGTVHMPRLFSFLSGDNQGIEAYF
HAQFLVVETASGKGKKSSLHFTYAFKPQCWYFIGLEHIGKHGILGNTESEVRLYVDGSLY
ESRPFEFPRISKPLAFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIGPERMAG
LASRGGDILPSFGNAAGLPWLSTNAYVHSKAEESVLLDAEIGGCIHLLYHPSLLNGRFCP
DASPSGASGVLRRPAEVLGQVHVATRMRPGDALWALAYGGPLSLLPVTISNIDEDTLEPL
QGNLSLSSATTSLAAPIFRIISIAIQHPRNNEELSRGRGPEVLSKILNYLLQTLSSLDVG
KHEGVGDEELVAAVVSVCQSQKINHTLKVQLFATLLLDLKIWSLCSYGIQKKLLSSLADM
VFTESTVMRDANAIQMLLDGCRRCYWIVREIDSVDSFSLAGATRPVGEINALVDELLVVV
ELLIVAAPPSLVSADVRCLLGFMVDCPQPNQVARVLHLFYRMVVQPNASRANTFAEEFLA
GGGIETLLVLLQREAKAGDSGVMESSSKNPELEKTEIDGSNENTERSQDDEGSEDKRSQS
VDSGNSPHHSSPDINSDRMAFASETSSVKNLGGISLSISADSARKNVYNIDKSDGIVVGI
IGLLGALVASGQLRFVSCASPDTTSNLYGVGLHDRGGTMFEDKVSLLLYALQKAFQAAPN
RLMTNNVYTALLAASINASSLEDGLNFYDSGHRFEHSQLLLVLLHSLPFAPRSLQSRALQ
DLLFLACSHPENRNSMINMEEWPEWILEILISNYEVGSSKLSDSTSVGDVEDLIHNFLII
MLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRVRREESLPIFKRRLLGVLLDFAA
RELQVQTQIIAAAAAGVAAEGLSPTDAKAEADNAAQLSVALVENAIVILMLVEDHLRLQS
KQSSSRTADISPSPLTTLYPISDHSTSLSTIDESAEEVADSRSSLSGGSGGNPLDALSSM
ADGTGQIPTSVMEKIAAAAAAEPYESVSCAFVSHGSCAKDLADGWKYRSRLWYGVGLPQN
PAAFGGGGSGWDFWKSTLEKDANGNWIELPLVRKSVAMLQALLLDESGLGGGLGIGGGSG
TGMGGMAALYQLLDSDQPFLCMLRMVLLSMREDDNGEDYMLMRNTSIDDAASEGRKPRSA
LLWSVLSPVLNMPISDSKRQRVLVASCVLYAEVYHAVSRDQKPLRKQYLEAILPPFVAVL
RRWRPLLASIHELATADGLNPLVADDRALAADSLPIEAALAMIAPAWAAAFASPPAAMAL
AMIAAGASGGESQAPAQTSHLRRDTSLLERKQTRLHTFSSFQRPLEVSNKTPPLPKDKAA
AKAAALAAARDLERFAKIGSGRGLSAVAMATSAQRRSASDMERVNRWNVSEAMGVAWMEC
LQPVGTKSVYGKDFNAFSYKYIAVLVASFALARNMQRSEVDRRAYVDIVTRHRISTGVHA
WRKLIHQLIEMRSLFGPSADNLYSPLRVFWKLDLMESSSRMRRCLRRNYQGSDHLGSAAD
YEEYSEEKKDQSTPILSAEAISLEAVNEDEEQVDAENLVDRVDDVQNKGDNQLSISESAE
QSVQASLESSSPQHASDEHIDQSSSAIAPGYVPSELDERIVLELPTSMVRPLKVIRGTFQ
VTSRRINFIVDNNSNETSAATDGFHSSFEAGNQEKDRSWLMSSLHQIYSRRYLLRRSALE
LFMVDRSNFFFDFGSSEGRRNAYRAIVQARPPHLNNIYLATQRPDQLLKRTQLMERWARW
EISNFEYLMQLNTLAGRSYNDITQYPVFPWILSDYNSESLDISNPSSFRDLSKPVGALNP
DRLKRFQERYASFDDPLIPKFHYGSHYSSAGTVLYYLVRVEPFTTLAIQLQGGKFDHADR
MFSDISGTWNGVLEDMSDVKELVPELFYQPEVLTNENSIDFGTTQLGGKLDTVKLPAWAE
NPIDFIHKHRKALESEYVSSHLHEWIDLIFGYKQRGKEAVAANNVFFYITYEGTVDIDKI
SDPVQQCATQDQIAYFGQTPSQLLTVPHLKKMPLAEVLHLQTIFRNPNEVKPYVVPSPER
CNLPAAAIHASSDAVVVVDMNAPAAHVAQHKWQPNTPDGHGTPFLFQHRKVTAGSAGGAL
MRMFKAPVSSGEEWRFPQAVAFSASGIRSQAIVSITCDKEIITGGHADNSIRLISSDGAK
TLETAYGHCAPVTCLGLSPDSNYLVTGSRDTTILLWRIHRALVSHSNVVSEHSTGTGTLS
PTSNSSSHLIEKNRRRRIEGPIQVLRGHRSEIISCCVNSNLGIVVSCSHSSDVLLHSIRR
GRLIRRLDGVEAHIVCLSSEGVVMTWNESQHSLSTFTLNGTPIARAQFSFFCSISCMQIS
NDGMSALIGINSQENGSSLNSQLNKSGVDFDSESEETDENSRTDLPSPSICFLDMHTLEV
FHILRLGEGQDITALTLNQDNTNLLVSTLDKQLIIFTDPSLSLKVVDQMLKLGWEGNGLQ
PLIKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]