dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Medtr8g035750.1 (Medicago truncatula )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | WD-40 repeat protein/beige protein | HC | chr8:13037122-13066469 | 20130731
Sequence length 2925
Sequence
MEEEEKPNEVKLSGDALDDKEVIDSIGGQLDESHQNKNVNDGSGIEDEQADKTESGKTVT
DGNRFDQVLLKDQEKNNVNVESIHSLGSDNVQDSVGGNEEEFQISSGMYSPESNTSPVPA
MQHDHISYSPGSGGHFGVGFGSTGYSPQTPKQKNAMPNTSAELLHLVDSAIMGKPEGMEK
LKNIASGVEILGSGEEMESVSFLIVDSLLATMGGVECFSEDGDNNPPSVMLNSRAAIVAG
ELIPWLPYVGDTDVVMSPRTRMVRGLLAILRACTRNRAMCSTAGLLSVLLRTADKIFTVD
VGLNGQIRWDGTPLCRCIQYLAGHSLSVSDLRKWFQVITRTLTTIWAPRLMLSMEKAINE
KESMGPACTFELDGESSGLLGPGESRWPFMDGYAFATWVYIESFVDALSAATVAAAIAAA
ASAKSGKASAVSAAAAASALAGEGTEHMPRLFSFLSSDNLGIEAYFHAQFLVVEIGSGKG
KRSALHFTYAFKPQCWYFIGLEHIGNHGAMGKAENEVRLYVDGSLYESRPFEFPKISKPL
SFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIGQERMARLASRGGDIVPSFGN
AAGQPWLASNAQMQNKAEESALLDAEIGGFIHLLYHPSLLSGRFCPDASPSGAAGMLRRP
AEVLGPVHVATRMRPVDALWAVAYGGPLSLLPLAISNIQEDTLEPHQGNFSVSVATTSLA
APIFRIISTAIQYPKNSEELGRCRGPEVISKVLNYLLQTLSSLGIGRDDGVGDEELVAAV
VLLCQSQKINHTLKVQLFTTLLLDIKFWSLCSYGIQKKLLSSLADMVFTESEVMRDANAI
QMLLDGCRRCYWTVPEKDPGNTVPLTGGRRPVGEVNALVDELLVVIELLIVAASPSLVSD
DVRCLLRFMVDCPQPGQISRVLHLFYRLVVQPNTSRVDTFVEAFLACGGIETLLVLLQRE
AKAGEIAVQESVSKFPGLQQNETDVSCESVQTFQDDERSDVKSESILQDNDQGSESFDSG
SNLDPGSPDGNMERMTSASEIHVKNLGGITLSISADSARKNVYNVDKSDGIVVGIIRLLG
VLVVSGHLKFGSHSVPDTTSNLLGVRLQDGGRTMFDDKVSLLLFSLQKAFQAAPNRLMTN
NTYTALLAASINASSTEKWLNFDDSGHRFEHSQLLLVLLRSLPFAPRPLQSRALQDLLFL
TCSHPENKGRLANMEEWPEWILEIMISNYELGPSKPSDSTSLGDIEDLLHNFLIVMLENS
MRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRIRREESLPIFKRRLLGGLMDFAARELQA
QTQVIAVAAAGVAAEGLSPDDAKAEAENAAHLSVALVENAIVILMLVEDHLRLQSKQSSS
SRVTDVSPSPLSIFYPTNSNSRSVIGQSTEVTSDRTPSSRNSGGISIDVLSSMADANGEI
STSVIEKLAAAAAAEPYESVSCAFVSYGSCAKDLALGWKYRSRLWYGVGLPSNIASFGGG
GSGWDVWKSTLEKDASGIWIELPLVRKSVAMLQSLLLDDSGLGGGLGIGRGSGTGMGGMT
ALYQLLDSDQPFLCMLRMILLSIREEDGKEENMLIRTNIEHAVSEGEKPYSALLWSVLAP
VLNMPVSDSKRQRVLVASCVLYSEVYHAVSIDRKPLRKNYLEAILPPFAAVLRKWRPLLA
GIHELATADGFNPLNVDDNVLAADTQPVEAALAMISPAWAAAFASPPSSMALAMIAAGTS
GGESHAPSSTNVQLRRDTSLIERKHARLHTFSSFQKPSEVPKQTPPLPNNKAATKAAAFA
AARDRQRFSRIGSGRGLSAVAMATSAQRRNESDMERVKRWNITEAMEVAWTECLQPVSTQ
SVYEKDFNALSYKFIAVLVASFASARNIQRSEVDRRAREDSITRHQISTGIRAWCKLIHQ
LIEMRSLFGPFADNLYSPLRVFWKLDFMESSSRMRRYMKRNYQGSDHLGCAANYEDYSGD
KNYQRTPVLSVEAISIATINKEKKKVETENMDAKVNNIAENQPRLSDAAEETVEMSLESN
ATQLQSHKGVVQNSSAFAPGSIPSEPDEKIVLELPSSMVQPLRVLQGTFQVTSRRINFIV
DNNETSTTVEGLNFDSAVGNQRKDRSWLMSSLHQVYSRRYLLRRSALELFMVDRMNFFFD
FGSSAGRRNAYRAIVHARPPHLNNIYLATQKPEQLLKRTQLMERWARWEISNFEYLMQLN
TLAGRSYNDITQYPVFPWILSDYSSESLDLSNPSSYRDLSKPVGALNPDRLKKFQERYNS
FDDPIIPKFHYGSHYSSAGTVLYYLVRVEPFTTLEIKLQGGKFDHADRMFSDISATWNGV
LEDMSDVKELVPELFYLPEVLTNENSIDFGTTQLGEKLDSVRLPAWAENPVDFVHKHRMA
LESEYVSAHLHEWIDLIFGYKQQGKEAIEADNVFFYITYERTVDIDKISDPVQQRATQDQ
IAYFGQTPSQLLTVPHMKKMPLNEVLHLQTIFRNPKVVKPYVVPSPEYCNLPAAAIQASS
DMIVVVDSNAPAAHVAQHKWQPNTPDGHGTPFLFQRGKAASGSGGGPLRRMFKGPTGTGE
EWQYPQALAFGVSGIRSQAIISITCDQEIITGGHADNSIKVISSDGAVTLETAHAHCAPV
TCVGLSSDSNYLVSGSRDTTILLWRFHKELPSNSSFISESSTGPGTPSSRNNSSSHLIEK
NRRRRIEGPIQVLQGHQSEILSCCVSSDLGIVVSCSETSDVLFHSIRTGRLFRRLDGVVA
HSVCLSSEGVIMTWNELQHTLSTFTLNGVLIAKTELSISTSISCMETSHDGRNALIGINP
LQNGRANGGNLQSSKETAIDIRSESEETHESNIINVPTPAICFLDLHTLEVFHVLKLKEG
QDITALALNKDNTNLLVSTSDKNLIIFTDPTLSLKVVDQMLKLGW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]