dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|448237620|ref|YP_007401678.1| (Geobacillus sp. GHH01)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfite reductase subunit beta/hemoprotein [Geobacillus sp. GHH01]
Sequence length 573
Sequence
MAKVELKAPDGPPSDVERIKQESRYLRGTLAETMEDPLSAGIPEDDNRLMKFHGSYLQDD
RDVRTERQKQKLEPAYQFMVRVRTPGGVATPEQWLVMDELARKYANGTLKLTTRQAFQLH
GVLKWNMKKTMQAINNALMTTLAACGDVNRNVMCNPNPYQSEVHAEVYEWAKLISDHLLP
RTRAYYEIWLDDEKVAGTPAVDGEEEPIYGPTYLPRKFKIGIAVPPSNDVDVFSQDIGFI
AIVEDGKLAGFNVAIGGGMGMTHGDKTTYPQLAKVIGFCRPDQVVEVAEKIMTVQRDYGN
RSSRKHARFKYTIDRLGLETVKEEIERRLGWKLGEARPYHFEHSGDRYGWVEGVNGTWHF
TLFVEGGRVKDYDDYKLMTGLREIAKVHTGDFRLTPNQNLVIANVTSEKKPEIEALIAEY
GLTDGRRYTALRRNALACVALPTCGLAMAEAERYLPKLLDKIEEIIDENGLRDEEITIRM
TGCPNGCARHVLAEIAFVGKAVGKYNMYLGAAFNGTRLGKLYRENIGEEEILRELRVLLS
RYAKERLDGEHFGDFVIRAGIVKEVTDGTNFHD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]