dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|384177899|ref|YP_005563662.1| (Bacillus thuringiensis serovar finitimus YBT-020)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfate transporter [Bacillus thuringiensis serovar finitimus YBT-020]
Sequence length 587
Sequence
MRGLFTERFEGYSLGHFQKDLLSGMIVGVVAIPLAMSFAIASGVKPEYGIYTTCIAGILI
SLFGGSKYQIGGPTGAFVPILLGIVITYGYESLLLAGLLAGIILCLMGIFKLGSLIKFIP
RPVTIGFTSGIAVIIFTGQIASFLGLTGIKKHEEFIANLQEIFTHIGTTNFYSVITALIC
FFVILITPKISPKVPGSLVGVVISTIIATVFFSGHVPTIGTAYGTIPNTLPQFDIPEITL
ERIKQLIGPAFVIAMLGGIESLLSAVVADGMTNSKHNSNKELIGQGIANIVTPLFGGIPA
TGAIARTATNIKSGATSSMSGIIHGVFVLFTLLLLAPYASHIPLASMAPILMVVAWNMSE
QKHFIHILKMKTGDSLVLLVTFLLTVFTSLTTAVEIGLILAVILFTKRMSNMLVISKVLP
DHTRKHEKLLPHVVNKAHDCPQISIYTIEGPLFFGAAQTFEQNILATIHYKPKVLILRMG
KVPFIDTTGESYFRNIVQHFKNQGGVLLISGIQSELKATLDKNRLYAEIGEENFFDHTGE
AINYALGHLNTKKCIGCKHFAFHECIELSQQSQEANTIKNKVNALDL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]