dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_001020038.1.4139 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment vacuolar protein sorting-associated protein 37A [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence length 398
Sequence
MSWLFPLTKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVSNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFPFLPSYPPQEAASRSITSLSVADTV
SSSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASINQNGFGYKMPDIPDAFPELSELSV
SQLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKSIEELARKNLLLEHSLETKRQAVLD
KYELLIQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEI
DDFLNSFKEKRTICHCRRAKEEKLHQVIAMHSQFHAPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]