dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_001070782.1.45394 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein Dr1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence length 176
Sequence
MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLVSSEANEICNK
SEKKTISPEHVINALESLGFGSYIAEVKDVLQECKTVALKRRKASSRLENLGIPEEELLR
QQQELFAKARQQQAELAQQEWLQMQQAAQQAQLAAASASSTQQAGSSQDEDEEDDM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]