dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_568537.1.80155 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence length 1193
Sequence
MLETNEQKGFDLNVCASIEDFSESDIKAEGETDSLVDGNVENVIEIKDKKKVIEREILIT
RRVLRSGSVARDLVNSDKHCKAVKRKGNVVSGGSSVDEVKEEVKQECVKSLVPEEIRGDD
FRSEVKVESKDDRSDDGKEEKVQRKRGRPRKFGMSSQSDDNGLISNCKLRTSLGKKKELV
GDDNVEKLVGGSCFNKEKAEVKLEHGEYAEDKEILGLDFRSQVKVEIKDDECGIVELHDE
ELQVKRKRGRPRKVQISSQSDESRPNTNCKLARTPELSSQSSVDRISLSRLRGRPPKTKE
TSVSLYIEKGPESNGRRMVRKRGRPPTPQKKRKSGMTDESDWKAKKRLKLCESPLESRHN
NPLIDDERMIGEQRSKQTEAGGHSRSKSKKMLSDRILQLLLTAGWTVEYRPRNGRAYQDA
VYLNPEGKTHWSVTKAYQVYKKQLESNPNDQKNSTTGSGFGLLPEEDLHLLERTIQKKRS
DTGKQRSKLKDRDTNDILVSTKGTGKIKREEKHSRKRCTPSARSSLKDVDSKEDGYILFE
GKRTMLGWMIDSTIVPLNGKVQCMDCKKTDILLEGIITKEGIRCNCCDEVFSVLDFEVHA
GGNRNQPFKSLYLEGGNSLLQCLHESMNKQSESQLKGYHFVDFGSGDPNDDTCGICGDGG
DLICCDGCPSTFHQSCLDIKKFPSGAWYCYNCSCKFCEKDEAAKHETSTLPSLSSCRLCE
EKCSKHYPHTLADHQACINQDGTVPGERSTDSFCGKYCQELFEELQLFIGVKHPLPEGFS
WSFLRRFELPSEVADCDISEKIAYNAKMAVAFSVMDECFSPLVDHRSGVNLLQNIVYNFG
SNFHRLDFSSFLTAVLERGDEIIAVASIRIHGNQLAEMPFIGTRYMYRRQGMCRRLMDGI
ESFVAYFSQMFLAISEVLLDVWQFCCYPACFGDGPFCFFSGFGFAPVNDSEKKTIKNLNL
LVFPGVDMLGKSLVKEKITDSVVSSPNGLVLLAPEMTLPVDVEENKPEESKDSAHERNCA
TAGVESPSNPVDSCLKLTYVEEGDNDRESNLKLLDGSVEEKEDTKKLTDIDINSLPDEVD
DSHADQSDTKEQEIDDKEDKTPLSDDGCEGKAEGTKESNQQPDSNKVDNSQPLGNGGTGE
ELGNRTLALKREVTPTLRASPRLIQRSWRTSRVNQKFTGTTNAVLLDSPHRCV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]