dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_000446832.1.100595 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: AraC family transcriptional regulator [Bacillus cereus group]; AA=GCF_000359445.1; RF=na; TAX=1297867; STAX=1392; NAME=Bacillus anthracis str. Sen3; strain=Sen3; AL=Contig; RT=Major
Sequence length 300
Sequence
MESYETQIQRSIDYIEEDVMEKQTLRNLARIAGFSESHFHRVFQALVGDTVMEYVRKRRL
ARAAYQLSHTDEKIIDIAFEHGFQSHETFTRAFKKLFQMTPSEYRKQEIETPMYYSVNVK
QRKLNPYLGGIQMEYRIVNKPEFLMAGYELKTTSKEGKNHQDIPAFWQEYLQKDLGTTIP
NRKDTSQWVELGLCTDFNLETGDFTYIIGMEVTDFENVPNEIAKRTFPAATYAVFTTPKV
PHEEMVSSIHQTWNAVFSEWFPHSGYEHCGVNEFELYDERSHADKSEFAQIELWIPVKKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]