dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_001227638.1.46476 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: glycine/betaine ABC transporter [Bacillus cereus group]; AA=GCF_000015065.1; RF=na; TAX=412694; STAX=1428; NAME=Bacillus thuringiensis str. Al Hakam; strain=Al Hakam; AL=Complete Genome; RT=Major
Sequence length 285
Sequence
MRKKIWFICLALFITMIFTSCNATNANSKGKIKLGVTSWKENIATANMWKVLLEQKGYKV
ELMYLEKAAIWTGVARGDVDANLEVWLPVTDKPLNNRYKDDIVLKSKWYEGTGLGLVVPS
YMKNISSIEDLNTHKDELDNKIIGIEPGSSLMNLTNKAMKKYDIKLKLVQSSEAALMSEL
KKAYTKKKPIAVTLWNPHWGFSEFDLKYLKDPKKVYGEKDDIYYSVRKGFEKDHPDIIKY
FDKWKMNDEQLGTLMVELNKTKDPEEAARKWIKKNQALVDEWIKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]