dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_002034214.1.63476 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: XRE family transcriptional regulator [Bacillus cereus group]; AA=GCF_002118205.1; RF=na; TAX=1405; STAX=1405; NAME=Bacillus mycoides; strain=SB8; AL=Scaffold; RT=Major
Sequence length 190
Sequence
MKENEDMQTKEVIQQVGQLLRQIRNEQKLSLEELAQKTGVSKLTLGKIERGETNPTLAVI
WKITKGLSIPLSRLMVVGEPVAVARCGEGFAVDVGQAWHLETMFRYTKETGMEMHRACLR
ANSIYEPEAHHEGAIELVTVMKGKVSIQVENDVYVLNEFDSIQFEANKKHSYKNEEDEVA
VLHLTMKYSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]