dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_002119694.1.90720 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: alanine racemase [Acinetobacter calcoaceticus/baumannii complex]; AA=GCF_001706415.1; RF=na; TAX=48296; STAX=48296; NAME=Acinetobacter pittii; strain=UKK-0538; AL=Contig; RT=Major
Sequence length 356
Sequence
MRQATVYIDRNALQYNLNRVKQLATNSKIVSMVKANAYGHGIKDCLAALNASDAFGVACL
QEGLEIRELGFQQPVTLIEGVFSEDEMPIAIKQKFECIIHHQQQFEWLIKHKQAYINQGL
KVWVKLNSGMNRLGFKNPEIIEVIKTLKSEGFTCVLAMHFANADVDHPLNEQQKQQFLQV
KQACDPVLASCCNSAAIYKWPELHFDYVRPGIMLYGASPFADQTVHDLDLKPVMTFSAEV
IALNHIQTNEHVGYGSTFCATQAMDIAIVSIGYGDGYPRAYIKPNYVAIDKQPCAVVGRV
SMDMIAIDVTGMKVKLGTPVELWGPHRLVDDVADANGTIGYELLCRLSNRPTRKST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]