dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_002128234.1.27729 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: MerR family transcriptional regulator [Bacillus cereus group]; AA=GCF_001484805.1; RF=na; TAX=1405; STAX=1405; NAME=Bacillus mycoides; strain=M2E_15; AL=Scaffold; RT=Major
Sequence length 277
Sequence
MDSYKLTKSDVIKIFNTTKETLRFYEEKGLVQPKVGKNNYRLYGNEDLQRISQIFFCKDM
GFSIEEIDLVINKRNIINNMNILQNKKNEIETEIHRFMEVQKKITRLLDLLQNRSRNFNK
IQSVYFEERKYYHIKGENFNSVKSFFDKFRSIFKQGEFFQEQFITMCPIKNFFNDDLGLS
VYYPVLNDTEMEHVDILSIPAGNYLCVDYVCTEGHMDEARRQIYTNIKDYIKRNGLQFRS
CNVIESDLHGLNLFYPEGQIIMNMQIPVEEKSKHQEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]