dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_002557156.1.72823 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcriptional regulator [Borreliella burgdorferi]; AA=GCF_000444465.1; RF=na; TAX=1328311; STAX=139; NAME=Borrelia burgdorferi CA382; strain=CA382; AL=Complete Genome; RT=Major
Sequence length 385
Sequence
MKILVIDIQGLIKQVFVRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNNISLPVVFIAQNEMLPNFGCLEQSKEKVKLIINKLNFKLTVDLFRSKYLA
LIKLELKNLGKNKLISSFEVKRIQAPDFSSNSKVELRENNLNDSSIRKSYRVSDVINFAP
KNDPDVIIKYQGLINKHKTGKIIVVGSSTGGTEALRIFLRSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYSSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGSNAIGVILTGMGDDGAVCMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVDKILPLSEIADHVLRRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]