dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003450306.1.52659 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycine--tRNA ligase [Clostridium perfringens]; AA=GCF_001949485.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=JFP834; AL=Contig; RT=Major
Sequence length 467
Sequence
MAVEKTMDKIVALCKNRGFIFPGSEIYGGLANSWDYGPLGVEFKNNVKRAWWKKFVQESK
YNVGLDSAILMNREVWVASGHVGGFSDPLMDCKECKARFRADKLVEDHMTANGAEVATAD
GWSNEELMDYITKNNIVCPKCGKLNYTDIRKFNLMFKTFQGITEDSKNEVYLRPETAQGI
FVNFKSVQRTTRKKVPFGIAQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGTDLEWF
NFWKDSCWNFLLNLGMKEENIRMRDHGEEELSFYSNATSDIEYLFPFGWGELWGIADRTD
YDLNKHAEHSGQDMTYLDPTTNEKYVPYVIEPSLGADRVALAFLVEAYDEEELEGANGKV
DVRTVMHLHPALAPFKAAILPLSKKLSEKADEVYAELSKHFNVDYDETGSIGKRYRRQDE
IGTPFCITVDFDTLEDGCVTVRDRDNMEQQRVKIEDVRAIIEKSLEF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]