dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003451156.1.35472 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anti-sigma F factor antagonist [Clostridium perfringens]; AA=GCF_001546355.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=MJR7757A; AL=Scaffold; RT=Major
Sequence length 111
Sequence
MWLDFEKIGNVLVVSLIGELDHHSAEEVRVKIDDRISRENIRKLVLDFSGVTFMDSSGIG
VIIGRYKKISMRSGEVNIISVSKSIKRVFELSGIFKIIKYYENLDEALKVG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]