dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003528052.1.48083 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: DNA-binding protein [Sinorhizobium/Ensifer group]; AA=GCF_000218265.1; RF=na; TAX=707241; STAX=382; NAME=Sinorhizobium meliloti SM11; strain=SM11; AL=Complete Genome; RT=Major
Sequence length 109
Sequence
MKQRNAKFEIGQVVRHRMFPFRGVVFDVDPEYANTEEWWNAIPQEIRPEKDQPFYHLFAE
NDESEYVAYVSEQNLVSDDSDRPIRHPQVDALFEKADAGHYKPKATYQH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]