dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003623528.1.15974 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment penicillin-binding protein 2B [Lactobacillus delbrueckii]; AA=GCF_000191165.1; RF=na; TAX=353496; STAX=1584; NAME=Lactobacillus delbrueckii subsp. bulgaricus 2038; strain=2038; AL=Complete Genome; RT=Major
Sequence length 720
Sequence
MKKTTNLGKIKSRAHGYRFTVGRILELVVALVFLFLAGRMLYLSISKTIDGQDISKRTAA
IYRRNTVLTANRGTIYDKNGLIIAQDSHTYTVYAILDKTYVDSNKKPLYVQDKEKTAEKL
VTVLPLSKAKILKYLNPKNKNTFQVQFGTAGSGLTLTEKKKIQAMHLTGIKFMETPSRLY
PNGVFASNVVGYTVSQNNSKTQTTELEGVTGLEAYFNKILKGTNGYETSMVDSSENQLPS
GFHSYKAAKDGDNLYLTIDSQLQSALETYMSKVQKNYKPKAMTVVIENLKTGKILAASQR
PTFNSQTKAGISEAGSNLLVQSSYEPGSVFKILSLAAAVNSGNYNPKSYYRSGSITVSGS
TIYDWQKSGWGTIPFSQAFPRSSNVGMVYLEKKIGAKLWRKYLNMFRITHKTGITLPGEV
SGSLSFSSPVDQAVTSFGQGVTVNVMQMMQVYSALANNGQMVRPQLVEKITDSSGKTIKS
YRVQKVGKKIFTAQTRKVVMQNMKKVLDKEIGTGHIYYMKGKDFGIKTGTAQIAKSTGGY
MTGDRDYVFSVVGITPTANPRYCIYLTMKQPSKLGSGAETILAQIFKPMMSRLVLLNKGD
KSASAVVKVPKFTGMTYAKAKKTATSNGLSLVRLGTGSKVLSQKAGAGETVSVGSTVFVL
TSRKISLPDLTGWSESQIEAYASLAGIKLQLSGSGKVKSQSLAQGTVVKSGTKLKVELKE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]