dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003624832.1.13261 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methylenetetrahydrofolate reductase [Acetobacter pasteurianus]; AA=GCF_000285275.1; RF=na; TAX=940265; STAX=438; NAME=Acetobacter pasteurianus subsp. pasteurianus LMG 1262 = NBRC 106471; strain=type strain:LMG 1262; AL=Scaffold; RT=Major
Sequence length 249
Sequence
MSLSRLSVELIPRSAEALAADVATVKAAFPAADTLNIPDLMRFPLRSWDAAALVRPQFGN
VIPHIRAIDIAPDAPLPGADQPGLEEILVVHGDPPADLSHRTYPNSTESIIRRYRREAPH
LKVYAAFDPYRRAPWKELEDVARKKEAGAIGFFTQPVFDLKLFDLCREWMQGECVFWGLS
PVIGPKSRSYWETTNHIVFPRDFSPTLDANIQFAQTVLKELAQEKGKAYLMPVRIKLEQY
LPALLDAVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]