dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003668326.1.2821 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment penicillin-binding protein 2B [Lactobacillus reuteri]; AA=GCF_001657495.1; RF=na; TAX=1598; STAX=1598; NAME=Lactobacillus reuteri; strain=CRL 1098; AL=Contig; RT=Major
Sequence length 719
Sequence
MNKKPQRTKNRGHRENRGTFGKWLFLITVGLFTLFIVRFAYIAINKDVQHVNLRSQAEQI
YTQQRIIQARRGDIYDSEGNPLATDTSKYTLYAVLDRTQKSSDGKPLYVKDRKKTAKVLS
QYIDLTPKQIEKILKPKGQAYQVEFGNAGSNLSVSTMQKIKNRHLPGINFIATPARQYPE
GEFASQIIGMATPKVKNDNGTEETNLVGQLGLEGYFNKQLTGINGLRKDKQDVYGYQIAN
SKQVTKKAINGDNIYTTLDSQTQHFLENKVNKVYKSSNANAMTAVVMEAKTGKIIAATQR
PTLHAENNPVWRNMLVQDAYEPGSVMKILSLAAAIDTGHFNPNATFNSGTWTMGGGKITD
WSSSGWGTISYKDAFDMSSNVGFAHVEQDMGAETWMKYIKRFGLLKKVNVIGMSNEVNGY
TSFKGILAQANTAFGQGITVNVMQMMQAFSAIGNNGKMMKPYIVSKVVDGNSGKTIQKVK
PKVVGQPIKASTAKKVLGYMQGVVYDQKGLGHDYQIKGYRIAGKTATAQIGGAHGYSTGD
TNYLYSFAGMAPAKNPKYIMYVTLRQPQNLKKPATKQIASVFNPTMKMLLSQQKVAEKAK
KKVITMPNVVGQASDEANKELSGKGMQVIVVGSGKKVKQQSAVPDEQVLTDQHVILDTGG
EYKMPDISGWSSADVQQLAKVLKLKVKENGNGYVTQQSISPDTTIKRGTTLTVQYEAKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]