dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003668386.1.8717 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine/threonine protein kinase [Lactobacillus reuteri]; AA=GCF_000016825.1; RF=representative genome; TAX=557436; STAX=1598; NAME=Lactobacillus reuteri DSM 20016; strain=DSM 20016; AL=Complete Genome; RT=Major
Sequence length 634
Sequence
MNPGYEIGHRYRIIRSLGEGGMANVYLAHDMVLDRDVSVKLLRLDLRDDPSTKRRFHREA
MAATQLNDPHIVGIYDVGEDHGLQYMVMQYVKGTDLKAYIKKHYPIPLPQVIDIMEQVLS
AVATAHAHGIIHRDLKPQNILIDENKNVKITDFGIAVAVSQDSLTQTNTLMGSVHYLSPE
QARGSIATKQSDIYSLGIILFELLTGKVPFEGETAVSIALKHFREEIPSVREQNKEIPQA
LENVIIKATAKEPAERYSSVNEMAADLKTVLDPERANEPRLKIQQDDNGETKVLDIKHLK
ADDYQPKKSTDSPTVDPSTKPQKWKKYGIVSGTLGMIVLIAVCSWWFLIRQVIIPDVEGM
TVQKAEQRLHQQNLRIGKITLVNSQAVDKNRIVSTNPDVSHKTRVSTPINLTVSTGVKQL
QMADYVGDDYSSVAANLRRKGFQVHQEPVYSDDIDKGQIIRQNHKKGTIVKPAANTIIFR
VSAGKEPIKIPNFKNQDISAVQQFANKNNLQLTTQEKKSKIIATNHVINQTPRAGSTLNH
GDTLTVSIANSGNQTKTTNIQINIPFDGNGGQRENRVQVYIRDANHNLTMEYQDITINQE
TTINVPFTLKQGETGAYRVVRNGRTIMSATNITG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]