dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003971818.1.43399 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: anti-anti-sigma factor [Streptomyces]; AA=GCF_000972395.1; RF=na; TAX=1415559; STAX=1415559; NAME=Streptomyces sp. WM6391; strain=WM6391; AL=Scaffold; RT=Major
Sequence length 143
Sequence
MSQAFPGPHGAPATGHVPVLRLGEVLLVTLQGDLHDSTAQQLQEDLAETIVRSGATGVVI
DVSGVEIVDSFLGRILAEIAGQTGLLAARTVLVGMRPAVAITLVELGLTLPGVHTALSTE
VAMELLRQQAPSSRFGGLRQESQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]