dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003976234.1.86682 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: fatty acid-binding protein DegV [Streptomyces]; AA=GCF_000403665.1; RF=na; TAX=1200984; STAX=1916; NAME=Streptomyces lividans 1326; strain=1326; AL=Chromosome; RT=Major
Sequence length 281
Sequence
MSRHVAIVTDSTAYLPARAMERHGITAVPLTVVLGDRALEEGTEISTRSLAQALQKRRPV
TTSRPNPELFAETYRRIAESGADGIVSLHLSAELSGTHDAAVVAAREAPVPVRVVDTGMI
AMALGFCALAAAETAEAGGTVDEAVTAAEKRAAGTSAYFYVDTLDYLRRGGRIGAAQALF
GSALAVKPLLQLEGGRIEPLEKVRTASKAIARLEEIAADRAGGAPVDIAVHHLAAPDRAS
ALADRLRDRVPGLADLHVSEVGAVIGAHTGPGLLGVVVSSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]