dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_004025782.1.78419 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: 50S ribosomal protein L20 [Ureaplasma]; AA=GCF_000169935.1; RF=na; TAX=526347; STAX=2130; NAME=Ureaplasma urealyticum serovar 11 str. ATCC 33695; strain=ATCC 33695; AL=Contig; RT=Major
Sequence length 120
Sequence
MRVKGGSVTRQRRKRWLEKAEGSWGTRNTSYRIARQTVIRAAEYAYRDRRNKKRDFRKLW
ISRINAAVRELGYTYSQFMNALVKANVVTKDGQGLNRKMLSELAINNPEAFNQLVNKVMK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]