dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_004302291.1.84276 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Bacteroides ovatus]; AA=GCF_000273195.1; RF=na; TAX=997885; STAX=28116; NAME=Bacteroides ovatus CL02T12C04; strain=CL02T12C04; AL=Scaffold; RT=Major
Sequence length 587
Sequence
MNRMIMKKYIFLIVTVVCLFACKDGDEVRQTTSPEASFSIDKEEYTVGDIVYLTDESVKT
EGEIVEYFWHFGFEGEGNRATTKDASVLYKKAGAYVIKLTVTDEFGGYATASHTVVIRPT
NMPPVTDFSYSPAICKVNEKVQFTDKSVDEDGEVVAYEWDFGNGQTSQEKDPEITFTTTG
FVTVKLTTTDDRGATNTKQATLYVRDTSISGVTILWDKTFETSSSLRSISPAVGDNGDVY
VSSNALHLFAYSPSGEQKWMFDLSKDGGAGDQGSSPMVGADGTIYMGASTTDKNISSSLY
AIHPDGTQKWRYELGIGTNIPYISPALSRDGNILIGNRGTDGSVHMVDRSSGRQLWRRKS
PNGGANGGISVGQNGVIHSALSGANGFARTTQDGVNLSPNLGKGNTAAAVYPAIDAQGNV
YVAFSEGVVAAYDNQGNELWRYPASGTMGKIDQGGPAIGADGTIYVGTKNPNAQVVALTK
GGAKKWSYSSVAEIGTTPAIDSDGNIHICDDGGNYIILNADGTEKYKRQLGSKIWSSPVI
ADYGIVYVTYEDNGACKLIAIDCGIEGPANSPWAQRGQNAKRNALQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]