dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_005752107.1.88402 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [Pasteurella multocida]; AA=GCF_001670445.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=DY120818; AL=Scaffold; RT=Major
Sequence length 484
Sequence
MSVKGDIGVIGLAVMGQNLILNMNDHGFKVVAFNRTTSKVDEFLQGAAKGTNIIGAYSLE
DLANKLEKPRKVMLMVRAGEVVDQFIEALLPHLEEGDIIIDGGNTNYPDTNRRVAYLREK
GIRFIGTGVSGGEEGARFGPSIMPGGDESAWEHVKPILQAISAKTDKGEACCDWVGRDGA
GHFVKMVHNGIEYGDMQLICEAYQFLKEGVGLSDDELEATFKAWRNTELDSYLIDITADI
LGYKDEDGSRLVDKILDTAGQKGTGKWTGINALDFGIPLTLITESVFARCVSSFKEQRVQ
ASRLFNKVVGKVEGDKAAWVEAVRKALLASKIISYAQGFMLIREASENFGWHINYGGTAL
LWREGCIIRSRFLGNIRDAYEANPDLIFLGSDAYFKGILENSLGEWRKVVAKSIEVGIPM
PCMASAITFLDSYTSERLPANLLQAQRDYFGAHTYERTDKPRGEFFHTNWTGRGGDAAST
TYDV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]