dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_006191748.1.43677 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L6 [Selenomonas sputigena]; AA=GCF_000160495.1; RF=na; TAX=546271; STAX=69823; NAME=Selenomonas sputigena ATCC 35185; strain=ATCC 35185; AL=Scaffold; RT=Major
Sequence length 183
Sequence
MSRIGRAPIEIPAGVTVKIEEVNKVTVKGPKGELFRELHPDMKIAVEGNVLTVTRPSDDK
EHRSLHGLTRTLINNMVVGVTEGFKKTLEINGVGYRAAKQGKNLNLSLGFSHPVIVEPPA
GITLDAPSATSIVVSGIDKEAVGAIAAKIRSYRLPEPYKGKGIKYEGEHIRRKVGKAGAK
AKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]