dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_008449901.1.32967 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella amnii]; AA=GCF_000378745.1; RF=representative genome; TAX=1122979; STAX=419005; NAME=Prevotella amnii DSM 23384 = JCM 14753; strain=DSM 23384; AL=Scaffold; RT=Major
Sequence length 180
Sequence
MKKEIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRIS
SPILSKYDVAIVLNQPSLDKFEEKVKPGGILIYEGNGIINPPTRTDIEIYRIDAVEKAAE
LKNSKVFNMIVLGGLLGVCPVVSNNGLEKALYKTLPERHHGLIPLNMQAVDEGKKIIRKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]