dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_008779633.1.86952 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: glycosyl hydrolase family 38 N- domain protein [Bacteroidales]; AA=GCF_000699905.1; RF=na; TAX=1339344; STAX=823; NAME=Parabacteroides distasonis str. 3999B T(B) 4; strain=3999B T(B) 4; AL=Contig; RT=Major
Sequence length 962
Sequence
MKKRTYLSAGLALLIGTLSVHASPGLSDVKSRVLPAVYKSKNGLTQKVEISVKHEGEPST
VTIRLGEQSRKEKLVSGDNVFRIEIPEVSTTRQLPLTLTSGKEKEETMVTVKPVRHWQMN
MVQHTHTDIGYTRSQMEILAEHLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEYLK
CRPAEQIARLKQRVKEGRIELATMYLNFDELPDEQTLAASLYPIKQFRENGMRAEVAMQD
DVNGIGWCFSEYFADAGVKYVNMGTHGHRALICFDKPTVFWWESPSGKKVLTYRAEHYNQ
GNFFGIHTDDFEQFEERVLAYLDQMEAKNYPYDILAAQHSGYFTDNAPPSTKSCEMLQKW
NEKYEWPKLRTAVASEFFKTVESQYADRIETIRGAWPDWWTDGFGSGAREAAISRVTHSD
IIANQAGLSFAKMLGAQLPTDINDRIQDINKALLFYDEHTFGHSESVRNAYGLETWEQRS
LKQSYAWEAYRHSGLLGEATMGILQSFVPKSDVPSIAVFNTLNWSYSGIAKAYVDHQILP
KDKAFEIVDTAGNVIPAQAGESRSDGTYWNFYVKDVPALGYAQYYIKVKDAPRPEIQGAT
ELKETHVENPWYAIDFNTRKGTIRKLYDKDLNKQLVTPDAEWEMGEFIYEIIDSRHPMEQ
YRAPQFLRRRPEKMRFEKYEKGDVWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIEVVY
RLRKKAVTDPEAVYIAFPFEVEGGKIHLDVPGGSIEAGVDQIPGSSNDWYTVQNFATARN
GESQVVMGSQEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGEMQWS
YFINSSKDNSIEYATKFAWENRIPFLTRVLPAGDKKVEPLQSASIFKIVPENLLLVNMRP
VEGENAVMLQLREIGGKPATFSVTSDKINFVKTTVCDVVGDPVSGNPLSFAPWENKFIKL
SW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]