dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_009873772.1.11732 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ABC transporter substrate-binding protein [Chlamydia trachomatis]; AA=GCF_001317745.1; RF=na; TAX=813; STAX=813; NAME=Chlamydia trachomatis; strain=LGV913; AL=Contig; RT=Major
Sequence length 257
Sequence
MCIKRKKTWIAFLAVVCSFCLTGCLKEGGDSNSEKFIVGTNATYPPFEFVDKRGEVVGFD
IDLAREISNKLGKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGEE
IKHLVLVFKGENKHPLPLTQYRSVAVQTGTYQEAYLQSLSEVHIRSFDSTLEVLMEVMHG
KSPVAVLEPSIAQVVLKDSPALSTATIDLPEDQWVLGYGIGVASDRPALALEIEAAVQEI
RKEGVLAELEQKWGLNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]