dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010319258.1.91986 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: MltR family transcriptional regulator [Vibrio]; AA=GCF_002078035.1; RF=na; TAX=55601; STAX=55601; NAME=Vibrio anguillarum; strain=HI618; AL=Contig; RT=Major
Sequence length 176
Sequence
MADRINESDIIERLNSAHSVRGFFITTVEVFNEAIDALMQRIFRKDNFAVQSVVGPLLQD
SGPLGNLSVRLKLLFGLGVLPDDVYHDIEDIIKLRNQLNSDGAEYEFTDPKILVPIKKLH
LVAKMGMVQLEVLEPDGDIELDFYQLQLQRQQQIIKSGLSLAIVEICNELNKESPF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]