dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010380485.1.82046 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M14 carboxypeptidase A [Pseudoalteromonas rubra]; AA=GCF_000238295.2; RF=na; TAX=1117318; STAX=43658; NAME=Pseudoalteromonas rubra DSM 6842; strain=ATCC 29570; AL=Contig; RT=Major
Sequence length 745
Sequence
MKKNLLGMLLLSTISVTATAHSDPHVAHVQALSADNHTLSTYQLAFSSETQKAEYLSRFH
TAILEVANNYLVLSLTQQEFAELHSAGALIFSKPGESNQSEAAVQGDISAISRAQSTVPE
SGIPNFSCYPTLAETQQMAQTLAQTYPDFVELKHIGPSWEKSQGLGGHDLTVLVLKNKKK
NKWRKRPALYMQGALHAREYTPGATTLKFAQYLLENRETDADVNWILNQREIHILLIANP
DGRVLAEQGQFWRKNTNTAYCALDETLRGVDLNRNFDFAWASPIGGSTDDQCAATFHGPS
PASEPETQAIQAYLHDLFKDRRGDLLTDPAPLNTQGVFLDLHSFSRFVMWPWSSELTPSP
NADQLSMMGHRMAAYNGYWAFQTQEIFKAGGSADGYAYGQLGVASFTFELGNEFFESCAN
FEGEIFPNNLNALIYAAKVAKRPYKLPAGPQFFDLRLKGAGKEAVPAGTPVEIIATVADD
LFGPSLTGQVPPSQAISKVELTIKKKGKRGRKRILLPAADGAFDTVSESLNYTLDTHRWR
KGRYTLTLRAQDASGQWGPKYAKFLTIDNEAMPGTQSPVADFIADCRKGICGFDGSATQD
DRDSLTYTWVLQGGQFFRVFHGEQVEIEYTLAGDYQLTLQVDDSHGNRDVKVVQLELDGV
TPPVVQFDYQCTGLTCEFNSSASYDPDGEIVERLWRMGNEPYIPGVETVVHTFAAPGEYI
VVFVAIDNDGQFSQVAQTIQVTSNE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]