dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010561090.1.94128 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M14 carboxypeptidase A [Pseudoalteromonas spongiae]; AA=GCF_000238255.2; RF=representative genome; TAX=1117319; STAX=298657; NAME=Pseudoalteromonas spongiae UST010723-006; strain=UST010723-006; AL=Contig; RT=Major
Sequence length 733
Sequence
MLRKLLISAAMLGAANAHAQPSQHYLVTFPNEDIEAKAKISLHHNLIGDRPNGVLFTLSS
EEQSLLKRFGATLQPADNLAKQFLTKQKNIFDKLTNTSTGIPGFSCYATVEETFQQVDDL
VAAHPEYTELVDIGDSWQKQNKGEGYDLKVLKIGKKDLVNPPILFIQSAMHARELATAAL
TLDFAKQLLAERETNADINWILETQQIHILFQTNPDGRKIAETGVSQRKNVNENHCLEAN
VGVDLNRNFSFGWGSVDGGSSGDACSATYRGDSPGSEPEVAAVENYVRSIFPDQRGPNIS
DAAPENTQGLYLDIHSYSQLILWPWGGSYDAAPNAKGLESLGRKLAYFNDYRPMQSVGLY
PTDGTSDNLAYGELGIAHITFELGTAFFQSCGYYGALVKPDNLKALLYAAKVTKAPYQLT
QGPDIADINFALNAQQQIVLKANATDTRFKNNSSWPMQNITKVRFAVNQLVSDDNQQLAT
FSDGNADSITEQFEIVINDNQLIDKKAIVYMQAQDSDGYWGTITAQSIDTNPPSVAGNVV
CSGAKCQFNVENPVSGFNYKWQLSSGDVLEGEEATHILPSLGDYSATLVVTNSIGVSNSL
AIHFNVTELFAPEVVASHRCNYLACEFDASLSTDADSNTLSYTWKAEDASASGKVFSHNF
SQSGSYKVELVVTDEHEQAARYEFDLKVEAEPEPVPLPEVPDDVKKESSGSNSLFMLFIL
TAGALIRRQRVKH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]