dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010802782.1.51638 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: hypothetical protein [Parabacteroides]; AA=GCF_000364265.1; RF=na; TAX=1235803; STAX=1235803; NAME=Parabacteroides sp. ASF519; strain=ASF519; AL=Scaffold; RT=Major
Sequence length 965
Sequence
MKTLKTLFLAGLALFAMSSFAWSGSTAPPGIETHLFPALYKTAKGPVQKVRVTVKHEGAS
ANATITLGDQSRKVKLNDGPNPFFFEIPQIQSTVQLPLTVTVGKEQESARVEVKPVRHWQ
MNMVQHTHTDIGYTRSQTEILAEHLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEY
LKCRPAEQIARLKKRVAEGRIELAAMYLNFDELPDEQTLAASLYPLKAFREAGMKAEVAM
QNDVNGIGWCFTEFFADAGVKYVNMGTHGHRALICFDIPTVFWWQSPSGKKVLTYRAEHY
NQGNFFGIHTDNFEQFEERVLNYLGEMEAKNYPYDIVAAQHSGYFTDNSPPSTKSCEMLM
KWNEKYEWPKLRTAVASEFIKDVETNYADKIQTIRGAWPDWWTDGFASGAREAAISRITH
SDIIANQAGLSFAGMLGAKLPAQIGNQIDDINKALLFYDEHTFGYSESVRNAYCKETWEQ
RSLKQSYAWEAYRHSGLLGEVTMGLLQSFVPKAEYPSVAVFNTLNWTYSGIAKVYIDHQI
LPREKAFEIVDAFGNIIPAQPAESRSDGTYWSLYVKDVPAFGYAQYYIKVKDEPRPAVQL
ADKLENAHVENPWYAIDFNTRKGTISKLFDKELNKELTTPNAEWELGEFIYEIIDSRHPM
EQYRAPQFLRRRPERIRFERYEKGAIWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIDI
VYRLRKKAITDPEAVYISFPFEVNQGKIFLDVPGGTIEAGVDQIPGSSNDWYTVQNFATA
RNSESQVVMGSPEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGELQ
WSYFINSSKDNSIGYATRFAWENRIPFLTRVLPAGAKGSKVVSPASVFNISSDNLLLVNM
KPVEGENAVMLQLREIAGKPAEFAVTSDKVNFTKVTVCDVVGDPIAGNATTDFVPWENKF
IKLSW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]