dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010883996.1.86829 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anti-sigma factor antagonist [Deinococcus radiodurans]; AA=GCF_000685985.1; RF=na; TAX=1121384; STAX=1299; NAME=Deinococcus radiodurans DSM 20539; strain=DSM 20539; AL=Contig; RT=Major
Sequence length 141
Sequence
MDRLPILKLGDCLLVTIQVELHDRLALTLQDDLTTMIANTGARGVLIDISALDIVDSFIA
RVLGNIAAMSRVLGAETMVVGMQPAVAITLVELGVTWQHMHTALSVERGLERLKVLIAER
HTLRGHSPRGKRGGGVDGSRH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]