dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010917040.1.10044 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment mevalonate pyrophosphate decarboxylase [Thermoplasma volcanium]; AA=GCF_000011185.1; RF=representative genome; TAX=273116; STAX=50339; NAME=Thermoplasma volcanium GSS1; strain=GSS1; AL=Complete Genome; RT=Major
Sequence length 359
Sequence
MDLPGIVSLLKEKGLYRAPGKYRKEMRYGEIHYGSGYPITGLIKFLGYYDESLKIANFPS
ISLNTDVSEAYSAFMISKDNGNDTAVVEGENSPNITKKAMTAINVFKNLYDIKGSFHFYL
RIKRKYAGAKGLGESAAVAAAASRSLVSALFEKEALKDSNFISIVARLASGSGSKSVAGP
LSLWLTAPAVSHEGSFSLNLRKEIDDIFLCAVPIRDSVSTAEAHNTVIKSPFYQQWSRLQ
FDAVYSIISRGGYSAQIIENATTNTYLMHSVLISTGKLLWNQDTLRAMGIVEDMRRIGRL
IGFSIDTGPSVLVMADREDLIKEFKERYNGECIDASVPNGAPDIPSSFVESAERYFAKH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]