dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010984310.1.49792 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chitinase [Streptomyces avermitilis]; AA=GCF_000968255.1; RF=na; TAX=227882; STAX=33903; NAME=Streptomyces avermitilis MA-4680 = NBRC 14893; strain=MA-4680; AL=Scaffold; RT=Major
Sequence length 607
Sequence
MRFGHRAVAGFATLLLPLAGLVGLASPAQAAGSATATYAKTQDWGTGFEGKWTVKNTGTS
SISSWTVEWDFPSGTSVTSAWDADVTSSGTHWTAKNKSWNGTLAPGASVSFGFNGAGSGS
PSNCKLNGDSCDGATTPGDAAPSAPGTPTASGITDTSAKLSWTAATDDKGVKNYDVLRDG
AKVATVTTTSYTDTGLTAGTDYSYTVQARDTADQTGPVSGAVAVHTTGGGTTPPPTGSAV
KLGYFTEWGIYGRNYNVKNLVTSGSASKITHINYAFGNVTGGKCAIGDSYADYDKAFTAD
QSVSGVADTWDQPLRGNFNQLRQLKAKYPNIKVLWSFGGWTWSGGFGAAAANPAAFAQSC
YDLVEDPRWADVFDGIDIDWEYPNACGLSCDTSGSAAYKNLMSALRAKFGSNNLVTAATT
ADGSSGGKIDAADYAGAAQYVDWYNVMTYDFFGAWDAQGPTAPHSPLTSYSGIPKAGFTT
ADAMAKFKAKGVPASKLLIGIGFYGRGWTGVTQDAPGGTATGPAAGTYEQGIEDYKVLKT
SCPATGTIAGTAYAHCGSNWWSYDTPATIGTKMAWAKSQGLGGAFFWEFSGDTGNGELVS
AINSGLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]