dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011034231.1.90340 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment argininosuccinate lyase [Methanosarcina mazei]; AA=GCF_000970205.1; RF=representative genome; TAX=213585; STAX=2209; NAME=Methanosarcina mazei S-6; strain=S-6; AL=Complete Genome; RT=Major
Sequence length 491
Sequence
MSNILRRGRLEAAQDEEILRYTSSMEADRWIFNADIVVDLAHTVMLREQGIIKEEDCSKI
LSGLLKIREEGMEKLDFSYEDIHISLESRLIDMVGEDVGGRMHSGRSRNDEVATCIRLTL
REELLGLLEEIFALRKTLVSLAEKHSETLMPGFTHLQHAQPTTLAHHLCAHESALGRDFD
RVQDAFSRVNLCPLGAAAFASTGFNLNRKRTQELLGFEGLLENSMDAVSSRDFLIECASV
FSNLMINLSRIAEELVIWSSSEFNFIELDDMYASTSSIMPQKKNPDTAELMRGKTGVSVG
ALMSLLTICKGLPLSYNRDLQEATPNIWRSVETVRASVRVMEGMVKTMKVHPDVLAAESI
TGFTTATELADTFVRETGIPFRTAHQIVGMLAKEREKPTMEKIDSASEVVLGESLSSKGL
TENMVKEALNPESNIKRRKIPGGPAPEEMKNYLSKRKTELELNAQEIATLKDIIDSAFEN
LLSVVEEYRKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]