dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011045666.1.15195 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment nitrite reductase large subunit [Colwellia psychrerythraea]; AA=GCF_000012325.1; RF=representative genome; TAX=167879; STAX=28229; NAME=Colwellia psychrerythraea 34H; strain=34H; BAA-681; AL=Complete Genome; RT=Major
Sequence length 866
Sequence
MNTDKQLLTKTNIVVVGNGMVGHHFVEEMAKNPNYQITVLSAESRLAYDRVHLSEYFGGK
TADDLAMTTPEHYEALGVTFKTNAKVILIDKIVQYVTTESGETYHYDKLILATGSYPFVP
PIPGKDQDHCLVYRTIDDLEDIAASAKESKVGVVIGGGLLGLEAANAIKQLGLQTHVVEF
APQLMGVQIDGGGGRLLRQKIEDLGVQVHTSKATSVIEKGNTSRYKLCFSDETELETDLI
LFSAGIRPYDNLAREFDLTLGERGGIVVNNQCQTSDENIYAIGECALWNNFIFGLVAPGY
AMAKVVAKHIAGFTNEGNGENGEIAEFTGADMSTKLKLMGVEVGSIGDAHGKTEGALTYT
YENQPEGVYKKIVVSSDKKSLLGAVLIGDTSEYDTLLQYMLNAIELPESPEGLILPMAAD
KPTLGVDALPDTATICSCHNVTKGDIIASIDAGAMTVGDVKSCTKAGSGCGGCAALVKSV
ADNEFEKRGVEVKKDICEHFAYSRQEIYDIVSVGKIKTFDELLEKHGRGLGCEICKPVAG
SVLASVWNDYILKKPHLSLQDTNDTYLGNMQKDGTYSVVPRIAGGEITPDKLIVLGEVAK
KYNLYTKITGGARVDLFGARVEQLPPIWKELVDAGFETGHAYGKSLRTVKSCVGSTWCRY
GVQDSMSMAIDLEHRYKGLRAPHKIKFGVSGCTRECAEAQGKDIGIIATDNGWNLYVAGN
GGMKPRHGDLFATDLDDETLVKYVDRILMFYVQTGDRLQRTSTWIDNLEGGLAYLQDVII
NDSLGLNDALETQMKAIVGTYQCEWKTTIEDPEALKRFQPFVNSDKSDSNIQFVTEREQI
RPARGQEKIDVKFIDATEKEAVAEEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]