dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011060616.1.39301 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: diaminopimelate decarboxylase [Pseudomonas fluorescens group]; AA=GCF_001906605.1; RF=na; TAX=380021; STAX=380021; NAME=Pseudomonas protegens; strain=PA19; AL=Scaffold; RT=Major
Sequence length 410
Sequence
MAIPFSPAQLVAAARQYGTPLWCYDAATIQARIAQLQAFDVVRYAQKASSNLHLLRLIRE
AGVRVDAVSLGEIERALLAGFSPVDAGIVFTCDLFDEATLARVVELQVEVNAGSIDMLRQ
LGEKSPGHRVWLRINPGFGHGHSRKTNTGGENSKHGIWHDQMSEALAVIRQHGLHLVGLH
MHIGSGVDYDHLEQVGAAMVAAVKSLDHDLEAFSIGGGLSTPYREGDTPVDVQRYANAWK
VARQEIEAYLGHGVRMEIEPGRFLVAEAGCLVSEVRVVKTAGQHHFVLVDTGFNDLMRPA
MYGAYHGMSLLDAAGHPVERPQQLTVVGGPLCESGDIFTQDDECLTPRPLPQARVGDLLV
LHDTGAYGASMSSNYNSRPLLPEVLFENGQPKLIRRRQPLADLLALELGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]